All AbMole products are for research use only, cannot be used for human consumption.

For this product's availability, delivery time and price, please email inquiry@abmole.com directly or click the "Inquiry Now" button below.
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide.
| Molecular Weight | 3490.06 |
| Formula | C171H250N40O39 |
| CAS Number | 2279952-25-7 |
| Storage |
Powder -20°C 3 years ; 4°C 2 years In solvent -80°C 6 months ; -20°C 1 month |
| Related GluR Products |
|---|
| AZD6765
AZD6765 is an NMDA receptor antagonist. |
| LY404039
LY404039 is a potent, selective and orally active agonist of recombinant human mGlu2, mGlu3 receptors with Ki of 149 nM, 92 nM respectively. |
| Felbamate
Felbamate(Felbatol) is an anticonvulsant compound used in epilepsy research. |
| CTEP
CTEP (RO4956371) is a novel, long-acting, orally bioavailable allosteric antagonist of mGlu5 receptor with IC50 of 2.2 nM, shows >1000-fold selectivity over other mGlu receptors. |
| VU 0361737
VU 0361737 is a selective positive allosteric modulator (PAM) for mGlu4 receptor with EC50 of 240 nM and 110 nM at human and rat receptors, respectively. |
All AbMole products are for research use only, cannot be used for human consumption or veterinary use. We do not provide products or services to individuals. Please comply with the intended use and do not use AbMole products for any other purpose.
Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2026 AbMole BioScience. All Rights Reserved.
