Free shipping on all orders over $ 500

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Cat. No. M52784

All AbMole products are for research use only, cannot be used for human consumption.

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW Structure

Price and Availability

For this product's availability, delivery time and price, please email inquiry@abmole.com directly or click the "Inquiry Now" button below.


Quality Control & Documentation
Biological Activity

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide.

Chemical Information
Molecular Weight 3490.06
Formula C171H250N40O39
CAS Number 2279952-25-7
Storage Powder          -20°C   3 years ;  4°C   2 years
In solvent       -80°C   6 months ;  -20°C   1 month
Related GluR Products
AZD6765

AZD6765 is an NMDA receptor antagonist.

LY404039

LY404039 is a potent, selective and orally active agonist of recombinant human mGlu2, mGlu3 receptors with Ki of 149 nM, 92 nM respectively.

Felbamate

Felbamate(Felbatol) is an anticonvulsant compound used in epilepsy research.

CTEP

CTEP (RO4956371) is a novel, long-acting, orally bioavailable allosteric antagonist of mGlu5 receptor with IC50 of 2.2 nM, shows >1000-fold selectivity over other mGlu receptors.

VU 0361737

VU 0361737 is a selective positive allosteric modulator (PAM) for mGlu4 receptor with EC50 of 240 nM and 110 nM at human and rat receptors, respectively.

  Catalog
Abmole Inhibitor Catalog




Keywords: VSGLNPSLWSIFGLQFILLWLVSGSRHYLW supplier, GluR, inhibitors, activators

All AbMole products are for research use only, cannot be used for human consumption or veterinary use. We do not provide products or services to individuals. Please comply with the intended use and do not use AbMole products for any other purpose.



Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2026 AbMole BioScience. All Rights Reserved.