Free shipping on all orders over $ 500

Recombinant Mouse Midkine (E. coli, C-His)

Cat. No. M10286

All AbMole products are for research use only, cannot be used for human consumption.

Recombinant Mouse Midkine (E. coli, C-His) Structure
Synonym:

MK; MDK; rm-midkine

Size Price Availability Quantity
5ug USD 130 In stock
Free Delivery on orders over USD 500 Bulk Inquiry?

Quality Control & Documentation
  • Purity: >98%, Endotoxin < 0.1 EU/μg
  • COA
  • MSDS
Biological Activity

Midkine (MDK) is a heparin-binding growth factor, which contains 121 amino acid residues with 5 disulfide bonds. It affects inflammatory responses, cell proliferation, adhesion, survival, tissue regeneration, differentiation and migration. Midkine promotes the growth, survival, and migration of various cells, and plays roles in neurogenesis and epithelial mesenchymal interactions during organogenesis.

Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human neutrophils is in a concentration range of 10-100 ng/ml.

MKKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGAD
CKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD with polyhistidine tag at the C-terminus.


Accession: P12025

Endotoxin < 0.1 EU/µg

Apparent Molecular Weight: 17 KDa, reducing conditions

Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.

Chemical Information
Form Lyophilized powder
Solubility (25°C) Reconstitute the lyophilized powder in distilled water up to 100 μg/ml.
Storage Stored at ≤ -20°C, stable for one year after receipt. Reconstituted protein solution can be stored at 2-8°C for 2-7 days and at -20°C for 3 months.
References

[1] Ludwig T Weckbach, et al. Blood. The cytokine midkine supports neutrophil trafficking during acute inflammation by promoting adhesion via β2 integrins (CD11/CD18)

[2] S Kojima, et al. J Biol Chem. Midkine enhances fibrinolytic activity of bovine endothelial cells

Related Cytokines and Growth Factors Products
Recombinant Human CD48/SLAMF2 (HEK293,C-Fc-6His)

Recombinant human CD48/SLAMF2 protein plays a vital role as an environmental sensor for regulating progenitor cell numbers and inhibiting tumor development. It is suggested that the anti-CD48 mAb has the potential to become an effective therapeutic mAb against multiple myeloma.

Recombinant Human IFNγ (CHO)

Human Interferon gamma (hIFN-γ) (CHO) is a dimerized soluble cytokine that is the only member of the type II class of interferons.

Recombinant Human EPO Protein (CHO)

Erythropoietin (EPO) is a glycoprotein hormone known primarily for its role in erythropoiesis, which is responsible for stimulating the proliferation and differentiation of erythroid progenitor cells.

Recombinant Human GM-CSF (HEK293, C-His)

Recombinant Human Granulocyte-Macrophage Colony Stimulating Factor is a hematopoietic growth factor and immune modulator.

Recombinant Human IL-1α Protein (E. coli)

Interleukin 1 (IL-1) is a peptide with a molecular mass of 17 kd and two isoforms, IL-1α and IL-1β. IL-1ɑ consists of 159 amino acids. Measured by its ability to induce interferon γ secretion from human natural killer lymphoma NK-92 cells, the ED50 of this effect is ≤100 ng/mL.

  Catalog
Abmole Inhibitor Catalog




Keywords: Recombinant Mouse Midkine (E. coli, C-His), MK; MDK; rm-midkine supplier, Cytokines and Growth Factors, inhibitors, activators

All AbMole products are for research use only, cannot be used for human consumption or veterinary use. We do not provide products or services to individuals. Please comply with the intended use and do not use AbMole products for any other purpose.



Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2026 AbMole BioScience. All Rights Reserved.