Free shipping on all orders over $ 500

Recombinant Human BMP-9 Protein (E. coli, His Tag)

Cat. No. M55353

All AbMole products are for research use only, cannot be used for human consumption.

Recombinant Human BMP-9 Protein (E. coli, His Tag) Structure
Synonym:

Bone Morphogenetic Protein-9; GDF-2

Size Price Availability Quantity
5ug USD 140 In stock
Free Delivery on orders over USD 500 Bulk Inquiry?

Quality Control & Documentation
  • Purity: >98%, Endotoxin < 0.01 EU/µg
  • COA
  • MSDS
Biological Activity

Bone Morphogenetic Protein-9 (BMP-9), also known as Growth differentiation factor 2 (GDF2), is an extracellular multifunctional cytokine that is also a member of the TGF-β family. BMP-9/GDF-2 selectively signals through ACVRL1 in endothelial cells. Additionally, it engages in high-affinity interactions with ENG, forming a heterotetramer or a heteromeric complex with ENG and ACVRL1.

Measure by its ability to induce alkaline phosphatase production by ATDC5 cells, the ED50 for this effect is <0.4 ng/mL.

SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGG
CFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPI
SVLYKDDMGVPTLKYHYEGMSVAECGCR with polyhistidine tag at the N-terminus.


Accession: Q9UK05

Endotoxin < 0.01 EU/µg

Apparent Molecular Weight: ~16 KDa, reducing conditions

Lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.

Chemical Information
Form Lyophilized powder
Solubility (25°C) Reconstitute the lyophilized powder in distilled water up to 100 μg/ml.
Storage Stored at ≤ -20°C, stable for one year after receipt. Reconstituted protein solution can be stored at 2-8°C for 2-7 days and at -20°C for 3 months.
Related Cytokines and Growth Factors Products
Recombinant Human HGF (CHO-expressed)

Recombinant human Hepatocyte Growth Factor (rhHGF) , also known as hepatopoietin-A and scatter factor, is a pleiotropic mitogen belonging to the peptidase S1 family (plasminogen subfamily). It is produced by mesenchymal cells and acts on epithelial cells, endothelial cells and haemopoietic progenitor cells.

Recombinant Human RIPK3 Protein (E. coli, N-His)

RIPK3 is a kinase that controls necroptosis and apoptosis. In necroptosis, activated by TNF-α and ZBP1, RIPK3 phosphorylates MLKL, leading to membrane damage. Necroptosis is dependent on receptor-interacting protein kinase 3 (RIPK3), a protein shown to play an important role in experimental models of critical illness. RIPK3 promotes kidney tubular injury via mitochondrial dysfunction. The FAO-dependent RIPK3 mediates pathogenesis of acute lung injury.

Recombinant Influenza B Hemagglutinin/HA Protein (HEK293, C-His)

Recombinant Influenza B Hemagglutinin / HA Protein is a homotrimer that recognizes target cells in vertebrates and does so by binding to salivary acid-containing receptors on these cells. When it binds to the target cell, it causes the host inner membrane to fuse with the viral membrane, thereby facilitating the entry of the viral genome into the target cell.

Recombinant Human FGF-9 (E. coli)

Fibroblast Growth Factor-9 (FGF-9) is a heparin binding growth factor that belongs to the fibroblast growth factor (FGF) family. ED50 < 2.0 ng/ mL, determined by 3T3 cell proliferation assay, corresponding to > 5.0× 105 units/mg.

Recombinant Human CXCL13/BCA-1 (E. coli)

CXCL13, also known as B-lymphocyte chemoattractant (BLC), is a CXC chemokine that is constitutively expressed in secondary lymphoid organs. Recombinant human CXCL13 is a single non-glycosylated polypeptide chain containing 87 amino acids and mature human BCA-1 shares 64 % amino acid sequence similarity with the murine protein and 23–34 % amino acid sequence identity with other known CXC chemokines. Determined by a chemotaxis bioassay using human B cells, the biological activity is in a concentration range of 1.0-10 ng/ml.

  Catalog
Abmole Inhibitor Catalog




Keywords: Recombinant Human BMP-9 Protein (E. coli, His Tag), Bone Morphogenetic Protein-9; GDF-2 supplier, Cytokines and Growth Factors, inhibitors, activators

All AbMole products are for research use only, cannot be used for human consumption or veterinary use. We do not provide products or services to individuals. Please comply with the intended use and do not use AbMole products for any other purpose.



Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2026 AbMole BioScience. All Rights Reserved.