Free shipping on all orders over $ 500

PMAP-36

Cat. No. M53560

All AbMole products are for research use only, cannot be used for human consumption.

PMAP-36 Structure

Price and Availability

For this product's availability, delivery time and price, please email inquiry@abmole.com directly or click the "Inquiry Now" button below.


Quality Control & Documentation
Biological Activity

PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG.

Chemical Information
Molecular Weight 4157.17
Formula C191H336N62O39S
CAS Number 154338-08-6
Storage Powder          -20°C   3 years ;  4°C   2 years
In solvent       -80°C   6 months ;  -20°C   1 month
Related Antibiotic Products
Kanamycin sulfate

Kanamycin sulfate is an aminoglycoside antibiotic that acts as a bacteriostatic agent by binding to the bacterial 30S ribosome.

Marbofloxacin

Marbofloxacin is a potent antibiotic of the 3rd generation fluoroquinolone group which inhibiting bacterial DNA replication.

Linezolid

Linezolid (PNU-100766) is a synthetic antibiotic. Linezolid acts by inhibiting the initiation of bacterial protein synthesis.

Daptomycin

Daptomycin is the first member of a new class of bactericidal antibiotics, the cyclic lipopeptides.

Sulfadimethoxine

Sulfadimethoxine (trade name Di-Methox, Albon) is a sulfonamide antibiotic.

  Catalog
Abmole Inhibitor Catalog




Keywords: PMAP-36 supplier, Antibiotic, inhibitors, activators

All AbMole products are for research use only, cannot be used for human consumption or veterinary use. We do not provide products or services to individuals. Please comply with the intended use and do not use AbMole products for any other purpose.



Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2026 AbMole BioScience. All Rights Reserved.