| Cat.No. | Name | Information |
|---|---|---|
| M3669 | Micafungin Sodium | Micafungin Sodium is an inhibitor of 1, 3-beta-D-glucan synthesis, it is an antifungal agent. |
| M5868 | Penicillin G Sodium | Penicillin G Sodium is a β-lactam antibiotic produced by Penicillin spp. |
| M4947 | Streptomycin sulfate | Streptomycin sulfate is an antibiotic produced by the soil actinomycete Streptomyces griseus. It acts by inhibiting the initiation and elongation processes during protein synthesis. |
| M4323 | Physcion | Physcion is an anthraquinone from roots of Rheum officinale Baill. |
| M2719 | G-418 disulfate | G-418 disulfate (Geneticin) blocks polypeptide synthesis by inhibiting the elongation step in both prokaryotic and eukaryotic cells. |
| M5415 | Amphotericin B | Amphotericin B (AmB) is an amphipathic polyene antibiotic which permeabilizes ergosterol-containing membranes. |
| M3594 | Neomycin sulfate | Neomycin sulfate belongs to a class of antibiotics known as the aminoglycosides. Neomycin is suitable for resistance screening in common prokaryotic cells. For resistance screening in eukaryotic cells using the neo gene (neomycin resistance gene) as a marker, G418 (M2719) is recommended. |
| M2391 | Ampicillin Trihydrate | Ampicillin Trihydrate is a β-lactam antibiotic, which inhibits bacterial cell-wall synthesis (peptidoglycan cross-linking) by inactivating transpeptidases on the inner surface of the bacterial cell membrane. |
| M4862 | Vancomycin HCl | Vancomycin HCl is a hydrochloride of vancomycin that is a narrow-spectrum glycopeptide antibacterial agent. Vancomycin hydrochloride acts by inhibiting the second stage of cell wall synthesis of susceptible bacteria. Vancomycin also alters the permeability of the cell membrane and selectively inhibits ribonucleic acid synthesis. |
| M2652 | Doxycycline monohydrate | Doxycycline monohydrate is a tetracycline antibiotic that commonly used to treat a variety of infections and MMP inhibitor. |
| M53562 | IN-2-LF | IN-2-LF is an inhibitor of lethal factor. |
| M53561 | KAMP-19 | KAMP-19, a keratin-derived antimicrobial peptide, is an antimicrobial peptide against P. |
| M53560 | PMAP-36 | PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. |
| M53559 | Tet-213 | Tet-213 is a antimicrobial peptide. |
| M53558 | D-K6L9 | D-K6L9 shows antimicrobial and antibiofilm activities against P. |
| M53557 | EcAMP3 | EcAMP3 is a hairpin-like peptide. |
| M53556 | GLK-19 | GLK-19 is an antimicrobial peptide, and is active against E. |
| M53555 | L-K6L9 | L-K6L9 shows antimicrobial and antibiofilm activities against P. |
| M53554 | LS-BF1 | LS-BF1 is a stable and low toxic cationic antimicrobial peptide. |
| M53553 | Mram 8 | Mram 8 is a cyclotide isolated from Viola philippica, a plant from the Violaceae family. |
| M53551 | DJK-5 | Diplacol ia a natural compound from from Mimulus clevelandi and shows potent inhibitory activities against lipopolysaccharide (LPS)-induced nitric oxide production. |
| M53550 | CaLL | CaLL is an antimicrobial peptide. |
| M53548 | PGLa | PGLa, a 21-residue peptide, is an antimicrobial peptide. |
| M53547 | PP13 | PP13 is an antimicrobial peptide, and is active against Gram-negative and Gram-positive bacteria E.coli (MIC: 16.7 uM), B. |
| M53546 | RP-1 | RP-1 is an antimicrobial peptide, and is active against S. |
| M53545 | XT-1 | XT-1 is an antimicrobial peptide derived from skin secretions of Xenopus tropicalis. |
| M53544 | XT-4 | XT-4 is an antimicrobial peptide derived from skin secretions of Xenopus tropicalis. |
| M53543 | K11 | K11 is an antimicrobial peptide. |
| M53542 | MCF | MCF is an antimicrobial peptide derived from bee venom. |
| M53540 | P1 | P1 is a broad-spectrum antimicrobial peptide. |
Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2026 AbMole BioScience. All Rights Reserved.
