Free shipping on all orders over $ 500

Antibiotic Antibiotic/Antibacterial

Cat.No.  Name Information
M3669 Micafungin Sodium Micafungin Sodium is an inhibitor of 1, 3-beta-D-glucan synthesis, it is an antifungal agent.
M5868 Penicillin G Sodium Penicillin G Sodium is a β-lactam antibiotic produced by Penicillin spp.
M4947 Streptomycin sulfate Streptomycin sulfate is an antibiotic produced by the soil actinomycete Streptomyces griseus. It acts by inhibiting the initiation and elongation processes during protein synthesis.
M4323 Physcion Physcion is an anthraquinone from roots of Rheum officinale Baill.
M2719 G-418 disulfate G-418 disulfate (Geneticin) blocks polypeptide synthesis by inhibiting the elongation step in both prokaryotic and eukaryotic cells.
M5415 Amphotericin B Amphotericin B (AmB) is an amphipathic polyene antibiotic which permeabilizes ergosterol-containing membranes.
M3594 Neomycin sulfate Neomycin sulfate belongs to a class of antibiotics known as the aminoglycosides. Neomycin is suitable for resistance screening in common prokaryotic cells. For resistance screening in eukaryotic cells using the neo gene (neomycin resistance gene) as a marker, G418 (M2719) is recommended.
M2391 Ampicillin Trihydrate Ampicillin Trihydrate is a β-lactam antibiotic, which inhibits bacterial cell-wall synthesis (peptidoglycan cross-linking) by inactivating transpeptidases on the inner surface of the bacterial cell membrane.
M4862 Vancomycin HCl Vancomycin HCl is a hydrochloride of vancomycin that is a narrow-spectrum glycopeptide antibacterial agent. Vancomycin hydrochloride acts by inhibiting the second stage of cell wall synthesis of susceptible bacteria. Vancomycin also alters the permeability of the cell membrane and selectively inhibits ribonucleic acid synthesis.
M2652 Doxycycline monohydrate Doxycycline monohydrate is a tetracycline antibiotic that commonly used to treat a variety of infections and MMP inhibitor.
M53562 IN-2-LF IN-2-LF is an inhibitor of lethal factor.
M53561 KAMP-19 KAMP-19, a keratin-derived antimicrobial peptide, is an antimicrobial peptide against P.
M53560 PMAP-36 PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG.
M53559 Tet-213 Tet-213 is a antimicrobial peptide.
M53558 D-K6L9 D-K6L9 shows antimicrobial and antibiofilm activities against P.
M53557 EcAMP3 EcAMP3 is a hairpin-like peptide.
M53556 GLK-19 GLK-19 is an antimicrobial peptide, and is active against E.
M53555 L-K6L9 L-K6L9 shows antimicrobial and antibiofilm activities against P.
M53554 LS-BF1 LS-BF1 is a stable and low toxic cationic antimicrobial peptide.
M53553 Mram 8 Mram 8 is a cyclotide isolated from Viola philippica, a plant from the Violaceae family.
M53551 DJK-5 Diplacol ia a natural compound from from Mimulus clevelandi and shows potent inhibitory activities against lipopolysaccharide (LPS)-induced nitric oxide production.
M53550 CaLL CaLL is an antimicrobial peptide.
M53548 PGLa PGLa, a 21-residue peptide, is an antimicrobial peptide.
M53547 PP13 PP13 is an antimicrobial peptide, and is active against Gram-negative and Gram-positive bacteria E.coli (MIC: 16.7 uM), B.
M53546 RP-1 RP-1 is an antimicrobial peptide, and is active against S.
M53545 XT-1 XT-1 is an antimicrobial peptide derived from skin secretions of Xenopus tropicalis.
M53544 XT-4 XT-4 is an antimicrobial peptide derived from skin secretions of Xenopus tropicalis.
M53543 K11 K11 is an antimicrobial peptide.
M53542 MCF MCF is an antimicrobial peptide derived from bee venom.
M53540 P1 P1 is a broad-spectrum antimicrobial peptide.




Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2026 AbMole BioScience. All Rights Reserved.