Free shipping on all orders over $ 500

Peptides

Cat.No.  Name Information
M53573 Maximin 3 Maximin 3 is an antimicrobial peptide derived from skin secretions of Bombina maxima.
M53572 Maximin 4 Maximin 4 is an antimicrobial peptide derived from skin secretions of Bombina maxima.
M53571 Maximin 5 Maximin 5 is an antimicrobial peptide derived from skin secretions of Bombina maxima.
M53570 Maximin 8 Maximin 8 is a antimicrobial peptide that can be found in B.
M53569 Parasin I Parasin I is a 19-amino acid histone H2A-derived peptide isolated from the skin of the catfish, and shows antimicrobial activity.
M53568 Ranalexin Ranalexin is an antimicrobial peptide.
M53567 GE 2270A GE 2270A (MDL 62879) is an antibiotic.
M53566 Abaecin Abaecin is an antibacterial response peptide.
M53565 AMPR-22 AMPR-22 is an antimicrobial peptide.
M53564 Arg-Trp Arg-Trp is a dipeptide composed of arginine and tryptophan, and analogues of Arg-Trp-octyl ester show antibacterial activity.
M53563 DFTamP1 DFTamP1 is an antimicrobial peptide against Staphylococcus aureus USA300 activity (MIC is 3.1 μM).
M53562 IN-2-LF IN-2-LF is an inhibitor of lethal factor.
M53561 KAMP-19 KAMP-19, a keratin-derived antimicrobial peptide, is an antimicrobial peptide against P.
M53560 PMAP-36 PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG.
M53559 Tet-213 Tet-213 is a antimicrobial peptide.
M53558 D-K6L9 D-K6L9 shows antimicrobial and antibiofilm activities against P.
M53557 EcAMP3 EcAMP3 is a hairpin-like peptide.
M53556 GLK-19 GLK-19 is an antimicrobial peptide, and is active against E.
M53555 L-K6L9 L-K6L9 shows antimicrobial and antibiofilm activities against P.
M53554 LS-BF1 LS-BF1 is a stable and low toxic cationic antimicrobial peptide.

  Catalog
Abmole Inhibitor Catalog



Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2026 AbMole BioScience. All Rights Reserved.