Free shipping on all orders over $ 500

Peptides

Cat.No.  Name Information
M52786 NT 13 NT 13 (TPPT) is a tetrapeptide having the amino acid sequence L-threonyl-L-prolyl-L-prolyl-L-threonine amide.
M52785 Tat-NR2Baa Tat-NR2BAA is the control peptide of Tat-NR2B9c, inactive.
M52784 VSGLNPSLWSIFGLQFILLWLVSGSRHYLW VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide.
M52783 L-Homocysteic acid L-Homocysteic acid (L-HCA) is an endogenous excitatory amino acid that acts as a NMDA receptor agonist (EC50: 14 μM).
M52782 Leptin (116-130) Leptin (116-130) is a bioactive leptin fragment.
M52781 Conantokin G Conantokin G, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors.
M52780 Conantokin-T Conantokin-T is a γ-carboxyglutamate-containing, N-methyl-D-aspartate (NMDA) antagonist peptidewith an IC50 value of 2 μM.
M52779 p-fin4 p-fin4 is a peptide inhibitor of STEP Phosphatase-GluA2 AMPA receptor interaction with a Ki of 0.4 μM.
M52778 Transdermal Peptide Disulfide Transdermal Peptide Disulfide (TD 1 Disulfide(peptide)) is a 11-amino acid peptide, binds toNa+/K+-ATPase beta-subunit (ATP1B1), and mainly interacts with the C-terminus of ATP1B1.
M52777 SPAI-1 SPAI-1 is a specific inhibitor for monovalent cation transporting ATPases.
M52775 α-Conotoxin PnIA α-Conotoxin PnIA, a potent and selective antagonist of the mammalian α7 nAChR, has the potential for the research of neurological conditions such as neuropathic pain and Alzheimer’s disease.
M52774 κ-Bungarotoxin κ-Bungarotoxin (κ-Bgt) is a potent, selective, and slowly reversible antagonist of α3β2 neuronal nicotinic acetylcholine receptors with an IC50 of 2.30 nM.
M52773 Rabies Virus Matrix Protein Fragment(RV-MAT) Rabies Virus Matrix Protein Fragment (RV-MAT) is a polypeptide.
M52772 αO-Conotoxin GeXIVA αO-Conotoxin GeXIVA is a potent α9α10 nAChR antagonist with an IC50 of 12 nM against rat α9α10.
M52771 αA-Conotoxin OIVA αA-Conotoxin OIVA (αA-OIVA) is a selective nAChR antagonist with an IC50 of 56 nM against mammalian fetal muscle nAChR.
M52770 αA-Conotoxin PIVA αA-Conotoxin PIVA is a selective mouse musclenAChR inhibitor with IC50 for adult and fetal mouse musclenAChR sub> values are 2.3 nM and 22 nM respectively.
M52769 α-Conotoxin AuIA α-Conotoxin AuIA is a potent and selective α3β4 n-nAChR inhibitor.
M52768 α-Conotoxin BuIA α-Conotoxin BuIA is a paralytic peptide neurotoxin and a competitive nAChR antagonist, with IC50s of 0.258 nM (α6/α3β2), 1.54 nM (α6/α3β4), 5.72 nM (α3β2), respectively.
M52767 α-Conotoxin Im-I α-Conotoxin Im-I is a selective α7/α9 nAChR antagonist, blocking α7 nicotinic receptors with the highest apparent affinity, while having an 8-fold lower affinity for homomeric α9 nicotinic receptors.
M52766 α-Conotoxin MrIC α-Conotoxin MrIC is an α7nAChR biased agonist.

  Catalog
Abmole Inhibitor Catalog



Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2026 AbMole BioScience. All Rights Reserved.