| Cat.No. | Name | Information |
|---|---|---|
| M52786 | NT 13 | NT 13 (TPPT) is a tetrapeptide having the amino acid sequence L-threonyl-L-prolyl-L-prolyl-L-threonine amide. |
| M52785 | Tat-NR2Baa | Tat-NR2BAA is the control peptide of Tat-NR2B9c, inactive. |
| M52784 | VSGLNPSLWSIFGLQFILLWLVSGSRHYLW | VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. |
| M52783 | L-Homocysteic acid | L-Homocysteic acid (L-HCA) is an endogenous excitatory amino acid that acts as a NMDA receptor agonist (EC50: 14 μM). |
| M52782 | Leptin (116-130) | Leptin (116-130) is a bioactive leptin fragment. |
| M52781 | Conantokin G | Conantokin G, a 17-amino-acid peptide, is a potent, selective and competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. |
| M52780 | Conantokin-T | Conantokin-T is a γ-carboxyglutamate-containing, N-methyl-D-aspartate (NMDA) antagonist peptidewith an IC50 value of 2 μM. |
| M52779 | p-fin4 | p-fin4 is a peptide inhibitor of STEP Phosphatase-GluA2 AMPA receptor interaction with a Ki of 0.4 μM. |
| M52778 | Transdermal Peptide Disulfide | Transdermal Peptide Disulfide (TD 1 Disulfide(peptide)) is a 11-amino acid peptide, binds toNa+/K+-ATPase beta-subunit (ATP1B1), and mainly interacts with the C-terminus of ATP1B1. |
| M52777 | SPAI-1 | SPAI-1 is a specific inhibitor for monovalent cation transporting ATPases. |
| M52775 | α-Conotoxin PnIA | α-Conotoxin PnIA, a potent and selective antagonist of the mammalian α7 nAChR, has the potential for the research of neurological conditions such as neuropathic pain and Alzheimer’s disease. |
| M52774 | κ-Bungarotoxin | κ-Bungarotoxin (κ-Bgt) is a potent, selective, and slowly reversible antagonist of α3β2 neuronal nicotinic acetylcholine receptors with an IC50 of 2.30 nM. |
| M52773 | Rabies Virus Matrix Protein Fragment(RV-MAT) | Rabies Virus Matrix Protein Fragment (RV-MAT) is a polypeptide. |
| M52772 | αO-Conotoxin GeXIVA | αO-Conotoxin GeXIVA is a potent α9α10 nAChR antagonist with an IC50 of 12 nM against rat α9α10. |
| M52771 | αA-Conotoxin OIVA | αA-Conotoxin OIVA (αA-OIVA) is a selective nAChR antagonist with an IC50 of 56 nM against mammalian fetal muscle nAChR. |
| M52770 | αA-Conotoxin PIVA | αA-Conotoxin PIVA is a selective mouse musclenAChR inhibitor with IC50 for adult and fetal mouse musclenAChR sub> values are 2.3 nM and 22 nM respectively. |
| M52769 | α-Conotoxin AuIA | α-Conotoxin AuIA is a potent and selective α3β4 n-nAChR inhibitor. |
| M52768 | α-Conotoxin BuIA | α-Conotoxin BuIA is a paralytic peptide neurotoxin and a competitive nAChR antagonist, with IC50s of 0.258 nM (α6/α3β2), 1.54 nM (α6/α3β4), 5.72 nM (α3β2), respectively. |
| M52767 | α-Conotoxin Im-I | α-Conotoxin Im-I is a selective α7/α9 nAChR antagonist, blocking α7 nicotinic receptors with the highest apparent affinity, while having an 8-fold lower affinity for homomeric α9 nicotinic receptors. |
| M52766 | α-Conotoxin MrIC | α-Conotoxin MrIC is an α7nAChR biased agonist. |
Products are for research use only. Not for human use. We do not sell to patients.
© Copyright 2010-2026 AbMole BioScience. All Rights Reserved.
